Whitemtauto - whitemtauto.com : White Mountain Auto | Used Car Dealership

White Mountain Auto is Northern New Hampshire and Vermont's largest provider of used automotive vehicles with Buy Here, Pay Here financing!

4.67 Rating by ClearWebStats

whitemtauto.com is 1 decade 7 years 5 months old. This website has a #9,155,912 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 1 out of 10. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, whitemtauto.com is SAFE to browse.

Updated 1 year 6 months ago

Get Custom Widget

Traffic Report of Whitemtauto

Daily Unique Visitors:	53
Daily Pageviews:	106

Estimated Valuation

Income Per Day:	$ 0.15
Estimated Worth:	$ 8.95

Search Engine Indexes

Google Indexed Pages:	Not Applicable
Yahoo Indexed Pages:	Not Applicable
Bing Indexed Pages:	Not Applicable

Search Engine Backlinks

Google Backlinks:	Not Applicable
Bing Backlinks:	Not Applicable
Alexa BackLinks:	Not Applicable

Safety Information

Google Safe Browsing:	No Risk Issues
Siteadvisor Rating:	No Risk Issues
WOT Trustworthiness:	Not Applicable
WOT Privacy:	Not Applicable
WOT Child Safety:	Not Applicable

Website Ranks & Scores

Google Pagerank:
Alexa Rank:	9,155,912
Domain Authority:	Not Applicable

Google Pagerank

PR 1 out of 10

PageSpeed Score

Siteadvisor Rating

No Risk Issues

Where is whitemtauto.com server located?

Hosted IP Address:

198.178.114.50

View other site hosted with whitemtauto.com

Hosted Country:

Location Latitude:

37.751

Location Longitude:

-97.822

Social Engagement

Facebook Shares:	Not Applicable
Facebook Likes:	Not Applicable
Facebook Comments:	Not Applicable
Twitter Count (Tweets):	Not Applicable
Linkedin Shares:	Not Applicable
Delicious Shares:	Not Applicable

Page Resources Breakdown

Homepage Links Analysis

View whitemtauto.com homepage link analysis

Page Title of Whitemtauto

White Mountain Auto | Used Car Dealership | New Hampshire & Vermont

Meta Tags of Whitemtauto

white mountain auto, white mountain auto broker, white mt auto, whitemtauto.com, buy here, pay here financing, new hampshire, vermont, whitefield, nh, used cars, preowned vehicles, car dealership, auto loan financing, sport utility vehicles, preowned trucks, used van, bad credit, auto loans, bad credit auto loans, guaranteed credit approval, guaranteed financing, auto financing, credit repair, used car auto loans, fast finance, parts, parts department, loans automotive, bankruptcy, buy here pay here, cheap used cars, used car dealers, reliable used cars, auto broker, best reliable used cars, warranty on used cars, bhph, quality used cars, no money down, easy financing, used car dealer, vehicle trade, we finance anyone, cheap reliable used cars, no credit, no credit check, rebuild your credit, preowned cars, guaranteed used cars, guaranteed auto financing, auto financing for bad credit, low payments, affordable payments, repossession no problem, used car with warranty, turned down for credit, declined for car loan, bad credit auto financing, auto finance companies, sub prime auto lenders, used cars for sale buy here pay here, buy here pay here car dealership, buy here pay here car, buy here pay here used cars, buy here pay here cars bad credit, buy here pay here lots, buy here pay here dealership, buy here and pay here, buy here pay here financing, best by here pay here, buy here pay here auto sales, auto credit, bad credit auto dealers, reliable cars, poor credit, credit challenged, bad credit no credit bankruptcy

Website Inpage Analysis

H1 Headings:	1	H2 Headings:	Not Applicable
H3 Headings:	Not Applicable	H4 Headings:	Not Applicable
H5 Headings:	Not Applicable	H6 Headings:	Not Applicable
Total IFRAMEs:	Not Applicable	Total Images:	15
Google Adsense:	Not Applicable	Google Analytics:	UA-61252366-3

Websites Hosted on Same IP (i.e. 198.178.114.50)

Used Car Dealership in Muncy, PA | Veterans Auto

- veteransautopa.com

Come to Veterans Auto in Muncy, PA to have an experience that meets and exceeds your expectations. We have the used car, truck, van, or SUV you need!

Not Applicable whitemtauto.com website value

$ 8.95

Jumping Jack Auto | Used Vehicles Denver, CO

- jumpingjackauto.com

Visit Jumping Jack Auto in Denver, CO to find the best selection of used vehicles. We can help you find the financing you need for a vehicle you'll love. Find the best savings on the highest quality vehicles.

5,712,529

$ 240.00

HTTP Header Analysis

HTTP/2 200
date: Mon, 17 Oct 2022 20:15:22 GMT
server: Apache/2.4.38 (Debian)
cache-control: no-store, no-cache, must-revalidate
cache-control: post-check=0, pre-check=0
pragma: no-cache
p3p: CP="IDC DSP COR ADM DEVi TAIi PSA PSD IVAi IVDi CONi HIS OUR IND CNT"
x-ua-compatible: IE=edge,chrome=1
content-security-policy: img-src 'unsafe-eval' 'unsafe-inline' blob: http: https: data:; script-src 'unsafe-eval' 'unsafe-inline' 'self' https:; style-src 'unsafe-inline' 'self' https: http:; default-src 'self' data: gap: https: wss://*.gubagoo.io
x-content-type-options: nosniff
referrer-policy: no-referrer-when-downgrade
feature-policy: sync-xhr *
expires: Mon, 24 Jan 2000 13:00:00 GMT
last-modified: Mon, 17 Oct 2022 20:15:22 GMT
strict-transport-security: max-age=31536000;
x-frame-options: SAMEORIGIN
vary: Accept-Encoding
content-encoding: gzip
content-length: 8075
content-type: text/html; charset=UTF-8

Domain Information for whitemtauto.com

Domain Registrar:	GODADDY.COM, LLC
Registration Date:	2006-10-27 1 decade 7 years 5 months ago
Last Modified:	2022-09-04 1 year 7 months 3 weeks ago

Domain Nameserver Information

Host		IP Address	Country
ns2.inmotionhosting.com		70.39.150.2	United States
ns1.inmotionhosting.com		74.124.210.242	United States

DNS Record Analysis

Host	Type	TTL	Extra
whitemtauto.com	A	900	IP:198.178.114.50
whitemtauto.com	A	900	IP:198.178.114.55
whitemtauto.com	NS	14400	Target:ns1.inmotionhosting.com
whitemtauto.com	NS	14400	Target:ns2.inmotionhosting.com
whitemtauto.com	SOA	14400	MNAME:ns1.inmotionhosting.com RNAME:null.inmotionhosting.com Serial:2022051101 Refresh:86400 Retry:7200 Expire:3600000
whitemtauto.com	MX	900	Target:mail.whitemtauto.com
whitemtauto.com	TXT	900	TXT:v=spf1 +a +mx +ip4:216.194.171.140 include:smtp.servconfig.com +ip4:198.46.90.218 +ip4:198.46.81.5 +include:dealermarketingservicesspf.smtp .com +a:ecbiz172.inmotionhosting.com +a:smtp.servconfig.com ~all

Similarly Ranked Websites to Whitemtauto

Optimize Survival — finding the best way to live

- optimizesurvival.com

finding the best way to live

9,155,938

$ 8.95

Account Suspended

- coxsbazarpress.com

9,155,940

$ 8.95

Académie Des Télécoms® | Centre de formation en Télécoms & Réseaux

- cabinet-logic.com

Fibre Optique, Cuivre, Réseaux mobiles... Avec plus de 15 ans d'expériences, LOGIC - Académie des Télécoms® propose des formations titrées RNCP, spécialisées dans les métiers des Télécoms et Réseaux. Son objectif ? Une formation, un emploi. Consultez nos offres de formations et trouvez le métier qui vous correspond !

9,155,946

$ 8.95

ATELIER957 | Unique Women's Clothing Boutique in St. Paul, Minnesota

- atelier957.com

We specialize in stylish boutique clothing: American and European clothing lines from small independent fashion designers who bring a personal touch to their high quality women's accessories and clothing for all ages and body types. Our trendy fashion boutique's brick and mortar location is in historic St. Paul, MN.

9,155,949

$ 8.95

AD PR

- ad-pr.de

9,155,964

$ 8.95

Full WHOIS Lookup for whitemtauto.com

Domain Name: WHITEMTAUTO.COM
Registry Domain ID: 648296836_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2022-09-04T05:28:40Z
Creation Date: 2006-10-27T14:42:03Z
Registry Expiry Date: 2022-10-27T14:42:03Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.INMOTIONHOSTING.COM
Name Server: NS2.INMOTIONHOSTING.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2022-10-17T20:15:23Z

Web stats for Whitemtauto - whitemtauto.com

Traffic Report of Whitemtauto

Estimated Valuation

Search Engine Indexes

Search Engine Backlinks

Safety Information

Website Ranks & Scores

PageSpeed Score

Siteadvisor Rating

Where is whitemtauto.com server located?

Social Engagement

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

Websites Hosted on Same IP (i.e. 198.178.114.50)

Used Car Dealership in Muncy, PA | Veterans Auto

Jumping Jack Auto | Used Vehicles Denver, CO

HTTP Header Analysis

Domain Information for whitemtauto.com

Domain Nameserver Information

DNS Record Analysis

Similarly Ranked Websites to Whitemtauto

Optimize Survival — finding the best way to live

Account Suspended

Académie Des Télécoms® | Centre de formation en Télécoms & Réseaux

ATELIER957 | Unique Women's Clothing Boutique in St. Paul, Minnesota

AD PR

Full WHOIS Lookup for whitemtauto.com